PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.004G024200.1
Common NamePHAVU_004G024200g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 333aa    MW: 36945.3 Da    PI: 6.8282
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.004G024200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.41.6e-181461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg WT+eEd +++ +v+ +G+g+W++++++ g++R++k+c++rw +yl
  Phvul.004G024200.1 14 RGLWTPEEDAKILAYVANHGTGNWTLVPKKAGLNRCGKSCRLRWTNYL 61
                        788*******************************************97 PP

2Myb_DNA-binding48.12.6e-1569110346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         ++T++E+el+++++   G++ W++Iar+++ gRt++++k++w++
  Phvul.004G024200.1  69 SFTPQEEELIINLHGAIGSR-WSLIARRLP-GRTDNDVKNYWNT 110
                         79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129427.371965IPR017930Myb domain
SuperFamilySSF466891.68E-3011108IPR009057Homeodomain-like
SMARTSM007175.5E-151363IPR001005SANT/Myb domain
PfamPF002492.5E-171461IPR001005SANT/Myb domain
CDDcd001678.35E-121761No hitNo description
Gene3DG3DSA:1.10.10.606.4E-2465116IPR009057Homeodomain-like
PROSITE profilePS5129418.4266116IPR017930Myb domain
SMARTSM007174.9E-1466114IPR001005SANT/Myb domain
CDDcd001677.33E-1169112No hitNo description
PfamPF002491.9E-1369110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGRPPCCDKS NVKRGLWTPE EDAKILAYVA NHGTGNWTLV PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHDSF TPQEEELIIN LHGAIGSRWS LIARRLPGRT DNDVKNYWNT KLRKKLMKMG  120
IDPVTHKPVS QVLSDLGSIS GLPNSTTTNQ MAFVNKDLMM SNMVPTKTEP SGSNKSMVEN  180
TQEDQVHSWE HHFPYQVLTT ENVQPHVFSE AASSTSSSSS SNLTHLGSPQ SYSCQTPHCS  240
SFDWSEFLHS DSFMWSLNPS SLVQSEADLS INAKSNGHDK QGVASIEGCC GAGMEYQTKK  300
QCEGHSFVDG ILDRDSELRA AFPELLDASF DY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007151175.10.0hypothetical protein PHAVU_004G024200g
SwissprotQ9LSI74e-88MYB35_ARATH; Transcription factor MYB35
TrEMBLV7BZ620.0V7BZ62_PHAVU; Uncharacterized protein
STRINGGLYMA13G04920.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.15e-88MYB family protein